PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42714.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 269aa    MW: 30226.2 Da    PI: 6.1626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42714.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
       KHN42714.1 14 KGPWTAEEDKKLINFILSNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.36.1e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
       KHN42714.1  70 LTQAEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.4961IPR017930Myb domain
SuperFamilySSF466894.87E-2711108IPR009057Homeodomain-like
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
CDDcd001675.05E-91661No hitNo description
PROSITE profilePS5129427.51362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2564116IPR009057Homeodomain-like
SMARTSM007174.3E-1566114IPR001005SANT/Myb domain
PfamPF002494.7E-1570111IPR001005SANT/Myb domain
CDDcd001671.16E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL SNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL TQAEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKMG  120
IDPVTHEPLN KQVSSKDSSS PAEHFSQVNN INIHQVEQND GVLNSEENST SSPAENSSGE  180
ESLLVDSICS DVSLINSMWL DETPLMDTLW DNTPKVENAN NNMGLPIGED NCAWLLDCQD  240
FGIHDFGFNC FSEVETNVLQ AIGMDRKGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311980.0KT031198.1 Glycine max clone HN_CCL_75 MYB/HD-like transcription factor (Glyma11g03300.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516672.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX61e-104ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B2SEL30.0A0A0B2SEL3_GLYSO; Protein ODORANT1
TrEMBLA0A0R0LER90.0A0A0R0LER9_SOYBN; Uncharacterized protein
STRINGGLYMA01G42050.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.11e-101myb domain protein 42
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]